PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12823A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 284aa    MW: 31047.8 Da    PI: 7.0096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12823AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.7e-093986247
                               SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                               ++WT+eE + + +a ++   +   +W+++a++++ +++  ++ ++++++
  Oropetium_20150105_12823A 39 DAWTAEENKVFEKALALIDRNapdRWEKVAAMLP-RKSVADVMNHYNDL 86
                               58*****************99*************.***********986 PP

2Myb_DNA-binding42.71.3e-13146190347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT++E+ l++ + +++G g+W+ I+r + ++Rt+ q+ s+ qky
  Oropetium_20150105_12823A 146 PWTEDEHRLFLLGLEKYGRGDWRNISRNFVTTRTPTQVASHAQKY 190
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.8983690IPR017884SANT domain
SMARTSM007171.2E-73789IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-103993IPR009057Homeodomain-like
CDDcd001674.04E-74086No hitNo description
Gene3DG3DSA:1.10.10.603.1E-44086IPR009057Homeodomain-like
PfamPF002493.4E-74086IPR001005SANT/Myb domain
PROSITE profilePS5129417.533139195IPR017930Myb domain
SuperFamilySSF466891.51E-17140195IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-18142193IPR006447Myb domain, plants
SMARTSM007172.6E-12143193IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-11143189IPR009057Homeodomain-like
PfamPF002492.5E-11146190IPR001005SANT/Myb domain
CDDcd001677.96E-11146191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MMAETWTQML LPTPGPCFSG QSCWPWPDRH AVGGGGGGDA WTAEENKVFE KALALIDRNA  60
PDRWEKVAAM LPRKSVADVM NHYNDLENDV GFIEAGLVPF PHYGGSLPSS GFTLDHWDDG  120
GDGGFRRGIC LKRARGPDQE RKKGVPWTED EHRLFLLGLE KYGRGDWRNI SRNFVTTRTP  180
TQVASHAQKY FIRLNSGGKD KRRSSIHDIT TANLHLQDDD RGGNASPSPS SALTTASNPA  240
GADVKPFMPP YPGVAHPYGN VKLEPTNGFV SGIGFDNCIL MQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1636109682RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970612.11e-139PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-73DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK01e-139K3XKK0_SETIT; Uncharacterized protein
STRINGSi002423m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-76Homeodomain-like transcriptional regulator